PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027070465.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 316aa    MW: 35013.7 Da    PI: 6.396
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027070465.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.3e-31115171258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     dDgy+WrKYGqK++k+s++prsYYrCt ++C +kk+ver++ dp++++itYeg H h
  XP_027070465.1 115 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCGAKKQVERCSGDPETLIITYEGLHLH 171
                     8******************************************************99 PP

Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    
MADLQPTPWS ADELVGELLD NESPFFIIPD QVAEASNLDV ASNHSPVYNR LMSAVYSGPT  60
MQDIESALSV TKYRNQTEHV SQARVSMLDR DLSRTHENNY RYTLRIKSCD NALADDGYKW  120
RKYGQKSIKN SPNPRSYYRC TNPRCGAKKQ VERCSGDPET LIITYEGLHL HFAYPFFPCN  180
RPQQQHVNSP AKKKQRKPTS SSNSQGRNDQ EAQRSVTSSI NDAEESPDNV THCSPVIPPP  240
PATVGDVNTG WEQKGTEGDY SPQGLLEDVV PLPIRNPLIN PTSVNSSSSS SFPSTPTSPS  300
SISWPPGYST LGFVGF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-45WRKY family protein