PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027068692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 587aa    MW: 64462.5 Da    PI: 8.5266
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027068692.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.2e-32256313260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  +++++ei+Y+g+Hnh+k
  XP_027068692.1 256 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-EGHITEIVYKGNHNHPK 313
                     8****************************************.***************85 PP

2WRKY105.23.5e-33421479159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  XP_027068692.1 421 LDDGYRWRKYGQKVVKGNPNPRSYYKCTYSGCPVRKHVERASHDLRAVITTYEGKHNHD 479
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    
MASSGGSLNT SLNSYSSYSF PNQFMATSFS DLINGNNTST SGNDQGMMNN RSNQDKPPFS  60
WELHDQMINK QAGTTPAEIP KFKSFPPTSL PLSPPPVSPS SFLAFPPSLS PSVLLDSPVL  120
FSNSSTLPSP TTGTFSSLVR KDEDTKFVSD FSFQSQTRPP LSSSSLFHAS AGKSSSQEAS  180
MKQHAGGWNF DNKPSQFIES SAVKHGIRSE LAPTTQRLGA EVPATQGSMQ SDPAPDSSHV  240
HYSQPSQYVR EQRKSDDGYN WRKYGQKQVK GSENPRSYYK CTFPNCPTKK KVERNLEGHI  300
TEIVYKGNHN HPKPQSTRRS SSQSIQNPSY THSEISHHSN TLGENAQTDS LPNAENSSAS  360
FGDDEFDQTS AISNSRDDDE NEPDAKRWKG ENDSEAISVS GSKTVREPRI VVQTTSDIDI  420
LDDGYRWRKY GQKVVKGNPN PRSYYKCTYS GCPVRKHVER ASHDLRAVIT TYEGKHNHDV  480
PAARGSGSYA VNRPSAINNN NDLPAAIKPL ATNSNSVYRT NFANSLQNPI PRPQSQAPFT  540
LQMLPSQGSF GISGNSASAN QVQQTGNAFH MAKQEPKDDL FFNSFLN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-124WRKY family protein