PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027066353.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 298aa    MW: 33115.7 Da    PI: 7.8581
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027066353.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.1e-3187143258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     dDgy+WrKYGqK++k+s++prsYYrCt ++C +kk+ver++ dp++++itYeg H h
  XP_027066353.1  87 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCGAKKQVERCSGDPETLIITYEGLHLH 143
                     8******************************************************99 PP

Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    
MADLQPTPWS ADELVGELLD NESPFFIIPD QVAEASNLDV ASNHSPKSNE HVSQARVSML  60
DRDLSRTHEN NYRYTLRIKS CDNALADDGY KWRKYGQKSI KNSPNPRSYY RCTNPRCGAK  120
KQVERCSGDP ETLIITYEGL HLHFAYPFFP CNRPQQQHVN SPAKKKQKPT SSSNSQGRND  180
QEAQRSVTSS INDAEESPDN VTHCSPVIPP HRQQSATSIQ DGQKGTEGDY SPQGLLEDVV  240
PLPIRNPLIN PTSVNSSSSS SFPSTPTSPS PFRGPGLFNL RLRRILGLYV ALVFTSTS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-41WRKY family protein