PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027065300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 417aa    MW: 45551.3 Da    PI: 8.2525
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027065300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.51.8e-25108163359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+Y+++Hnh+
  XP_027065300.1 108 DGYNWRKYGQKQVKSPQGSRSYYRCTYSECCAKK-IECSDDSNRVMEIVYRSHHNHD 163
                     9*******************************98.*********************7 PP

2WRKY100.97.3e-32279336259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++er+++++++v+itY+g H+h+
  XP_027065300.1 279 ADGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIERAKDNTNAVIITYKGVHDHD 336
                     6********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    
MQRLEPAEEL KDQVGMSYQE EFRIIADQAV PDQTQNQQEP PNGPRSSEPS PTSVTQPISS  60
VPSPTLPEQK MSPGDNRNTX HTSEADKKNS FDPKTLSVVS IQKTPSPDGY NWRKYGQKQV  120
KSPQGSRSYY RCTYSECCAK KIECSDDSNR VMEIVYRSHH NHDPPQKVNC TGEAGIHVIA  180
PANGSDSSVA PIGATADSAP STSSKDSIQE KXSVPDPIQK DSSDSDDNAE TNIKQEREDE  240
PEPSKRLKKT VASCSAPLLK PGKKPKIVVH AASDVGISAD GYRWRKYGQK MVKGNPHPRN  300
YYRCTSAGCP VRKHIERAKD NTNAVIITYK GVHDHDMPVP KKRHGPPSAP LVAAAAPASM  360
STVQVVKSET IQNQVSATQW SVDKEGGLKG QTLECGGEKN VESARTLLSI GFEIKPC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-113WRKY family protein