PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027065033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 561aa    MW: 61460.1 Da    PI: 7.0425
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027065033.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.33.7e-29280338160
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     ldDgynWrKYGqK vkg+ f rsYY+Ct+++C++kk+ver + d+++++i+Y g+H+h+k
  XP_027065033.1 280 LDDGYNWRKYGQKLVKGNVFVRSYYKCTYSTCRAKKQVERLH-DGRLTDIKYIGKHEHPK 338
                     59****************************************.***************85 PP

2WRKY105.33.2e-33457515159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK vkg+++prsYYrC+ agC+vkk+vers++dpkvv++tYeg+H+h+
  XP_027065033.1 457 VNDGYRWRKYGQKLVKGNPNPRSYYRCSNAGCTVKKHVERSSHDPKVVITTYEGKHDHD 515
                     58********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    
MQPRDSPHNG VPVSPSNSGE VVSCVVLKIE SGSLQQKQIS ASESCEPEAH KVPPLVKNEK  60
DELNQWQSHG AGNHSTAYGE TEVLDSGKDV AISNQVSIIP KKELVSDGQL HASVSSKQLI  120
PENGNRASQF NQVSVQPKEE LGPSEQNLSP HTGSNTPMSG EKLIPESGTH VSQFNHVSII  180
TKMDPDGPEQ EQGTDAGKDA SLPCEGGGTD SSVLEKSLQH MQNTNMRVCT SSSDQEKITY  240
SAKPEKVLYK LQPRRNPDSG VHATQSEQGS NSPRIREKAL DDGYNWRKYG QKLVKGNVFV  300
RSYYKCTYST CRAKKQVERL HDGRLTDIKY IGKHEHPKLQ SSPQCTAFVS PSEVSKADMP  360
AIATSEAEDE LVVAHNDKPQ PIDPAETPRE LAATASNNST GKAVPQLHNP RDDIDNDFSP  420
TSKRQKRETC DVHNNQVKKT HCESRQVVHM MSEVDIVNDG YRWRKYGQKL VKGNPNPRSY  480
YRCSNAGCTV KKHVERSSHD PKVVITTYEG KHDHDMPASR TVGHSATESG TNGTTMKGEA  540
KSEIGEHNAV GVDLIVNIGA N
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.23e-74WRKY family protein