PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027063771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 634aa    MW: 68575.9 Da    PI: 6.5087
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027063771.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY993e-31278335260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  XP_027063771.1 278 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 335
                     8****************************************.***************85 PP

2WRKY107.18.6e-34450508159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct+agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_027063771.1 450 LDDGYRWRKYGQKVVRGNPNPRSYYKCTHAGCPVRKHVERASHDPKAVITTYEGKHNHD 508
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    
MEEASSLQSR YHSPHAFEQL HQQQVEEQQS GACSNVEMDG RLTSSLQRVR DGNGNGNGNY  60
SEAAAAYHHS AAAAGGGGAK YKLMSPAKLP ISRSPCTLTI PPGLSPTSFL ESPVLLSNIK  120
AEPSPTTGTF SMPQMMQGSS GTSGFSYLTN CSSLNTVNKT NSCNFEFQFH ADSGDAAGLR  180
PIGLAVSSGL VQQHNKSLGQ VPDSGLSQSL VSSSLVKHEV VMAKESNFSA PTTISDCATT  240
AVDSDVLNQK NHPNISNQVS NSDSKDTTSS VANDRSSDDG YNWRKYGQKL VKGSEFPRSY  300
YKCTYPNCEV KKIFERSPEG QITEIVYKGS HDHPKPQPSR RFTPGALLSI QEEKFDKDST  360
FTGQEDKLNV NSQNTSVEPN STPVPSPQQE NDDGLDGTLS KLQCVNDEID EDDPFSKRRK  420
LDGSLDVTPV VKPIREPRVV VQTVSEVDIL DDGYRWRKYG QKVVRGNPNP RSYYKCTHAG  480
CPVRKHVERA SHDPKAVITT YEGKHNHDVP TARTSSHEMA GPATMGAMSR IRSEEDDPLS  540
LDLGVGISYG AEHRPDAQLQ MLNSEPLQSQ VRAAASTRMV VQASTLPACY GVVNGGITLY  600
GSKENLDEGG GFGTAPLRSS NQCPQNLGRI ILGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-158WRKY family protein