PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027063715.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 635aa    MW: 68687.2 Da    PI: 6.5563
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027063715.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY993e-31279336260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  XP_027063715.1 279 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 336
                     8****************************************.***************85 PP

2WRKY107.18.6e-34451509159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct+agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_027063715.1 451 LDDGYRWRKYGQKVVRGNPNPRSYYKCTHAGCPVRKHVERASHDPKAVITTYEGKHNHD 509
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    
MEEASSLQSR YHSPHAFELL QQQQVEEQQS GACSNVEMDG RLTSSLRRVR DGNGNGNGNY  60
SEAAAAYHHS AAAAAGGGGA KYKLMSPAKL PISRSPCTLT IPPGLSPTSF LESPVLLSNI  120
KAEPSPTTGT FSMPQMMQGC SGTSGFSYLT NCSSLNTVNK TNSCNFEFQF HADSGDAAGL  180
RPIGLAVSSG LVQQHNKSLG QVPDSGLPQS LVSSSLVKHE VVMAKESNFS APTTISDSAT  240
IAVDSDVLNQ KNHPNISNQV SNSDSKDTTS SVANDRSSDD GYNWRKYGQK LVKGSEFPRS  300
YYKCTYPNCE VKKIFERSPE GQITEIVYKG SHDHPKPQPS RRFTPGALLS IQEEKFDKDS  360
TFTGQEDKLN VNSQNTSVEP NSTPLPSPQQ ENDDGLDGTL SKLQCVNDEI DEDDPFSKRR  420
KLDGSLDVTP VVKPIREPRV VVQTVSEVDI LDDGYRWRKY GQKVVRGNPN PRSYYKCTHA  480
GCPVRKHVER ASHDPKAVIT TYEGKHNHDV PTARTSSHEM AGPATMGAMS RIRSEEDDPL  540
SLDLGVGISY GAEHRPDAQL QMLNSEPLQS QVRAAASTRM VVQASTLPAC YGVVNGGITL  600
YGSKENLDEG GGFGTAPLRS SNQCPQNLGR IILGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-156WRKY family protein