PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027063441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 337aa    MW: 37492 Da    PI: 7.0827
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027063441.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.47.3e-34197254259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCts++C vkk+vers +dp++v++tYeg+Hnh+
  XP_027063441.1 197 EDGYRWRKYGQKAVKNSPFPRSYYRCTSQKCIVKKRVERSFQDPSIVITTYEGQHNHH 254
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    
MSDHHRNDGY HYGTNSFYHD YMGTGGSTST FPFFGGGNSL MYNQPSTSQN LAGSSSAYDP  60
TSYMSFTDCL QGTAADYNNL SGAFDMSCNS LPDQSVCPVD NSSADKNTTS LGEAAAGAAT  120
TSAENPRTPV SSLSCSSNET GVEEESSKSN TTDLQTKGSE DRDDKSKKLN KPKKKGEKKP  180
REPRFAFLTK SDIDHLEDGY RWRKYGQKAV KNSPFPRSYY RCTSQKCIVK KRVERSFQDP  240
SIVITTYEGQ HNHHCPATLR GNAAAMLSPS FLSSNSASLP TFPPEFITHM LPSTSRNYQN  300
PPYYQNFNPQ DQQFQLPHDY TNFFQDMNPS FMHKPEP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.13e-51WRKY family protein