PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027062251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 496aa    MW: 54509.5 Da    PI: 7.449
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027062251.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.53.1e-29280338160
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     ldDgynWrKYGqK vkg+ f rsYY+Ct+++C++kk+ver + d+++++i+Y g+H+h+k
  XP_027062251.1 280 LDDGYNWRKYGQKLVKGNVFVRSYYKCTYSTCRAKKQVERLH-DGRLTDIKYIGKHEHPK 338
                     59****************************************.***************85 PP

2WRKY35.42.1e-11457478122
                     ---SS-EEEEEEE--TT-SS-E CS
            WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                     ++Dgy+WrKYGqK vkg+++pr
  XP_027062251.1 457 VNDGYRWRKYGQKLVKGNPNPR 478
                     58*******************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    
MQPRDSPHNG VPVSPSNSGE FVSCVVPKIE SGSLQQKQIS ASESCEPEAH KVPPLVKNEK  60
DELNQWQSHG AGNHSTAYGE TEVLDSGKDV AISNRVSIVP KKELVSDGQL HASVSSKQLI  120
PENGNRASQF NQVSVQPKEE LGPSEQNLSP HTGSNTPMSG EKLIPESGTH VSQFNHVSII  180
TKMDPDGPEQ EQGTDAGKDA SLPCEGRGTD SSVLEKSLQH MQNTNMRVCT SSSDQEKITY  240
SAKPEKVLYK LQPRRNPDSG VHATQSEQGS NSPRIREKAL DDGYNWRKYG QKLVKGNVFV  300
RSYYKCTYST CRAKKQVERL HDGRLTDIKY IGKHEHPKLQ SSPQCTAFVS PSEVSKADMP  360
AIATSEAEDE LVVAHNDKPQ PIDPAETPRE LAATASNNST GKAVPQLHNP RDDIDNDISP  420
TSKRQKRETC DVHNNQVKKT HCESRQVVHM MSEVDIVNDG YRWRKYGQKL VKGNPNPRDL  480
VLSRGMSNLG GSSKGT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.12e-45WRKY family protein