PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_09.500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family Nin-like
Protein Properties Length: 613aa    MW: 68226 Da    PI: 6.9787
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_09.500genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.85.9e-30531581252
                        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                   ek+isl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  evm.model.AsparagusV1_09.500 531 EKNISLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 581
                                   89***********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    
MENLHRETGF GLRYIQQSPM DSFTPVDCST GSPISDDFFG LSALLTSDSY PDLFSPFSYS  60
SSPFSYSTLQ QFPNSSNDMN NFTLSSADAS DERMVSAIPK SIPGFTLAER MLKALSLFKE  120
SSGGGILAQV WMPVKHGNGH VLSTSDQPFL LDQILAGYRE VSRAFTFSAE EAPGLFPGLP  180
GRVFISGLPE WTSNVVYYNN VEYLRAEYAH THEVKGSLAV PVFDPKERSC CAVLELVTTK  240
EKPDFDMEME SVCNALQAVD LRSIKGQPYQ QLLTKNQKSA FNEILDVLRA CCHAHMLPLA  300
LTWVPFSYEG DRVPDATKEV IREVNSNLMK KSLLCIEESA CYVNDSRMNG FLHACSEHCL  360
EKGQGISGKA LQSNHPFFSP DVKGYGIREY PLAHHARKYG LNAAVAIRLR SKLTDNDDYI  420
LEFFLPVNCR GSTEQQELLN NLSNTMQRIC RSLRTVSDDE IHATEKKVGT NSPSPEISIK  480
CPQQMDSDNE VLADFSFDDI SAKSGERGDA NCEQFKSDST KQTEKKRSTS EKNISLSVLQ  540
QYFSGSLKDA AKSIGVCPTT LKRICRQHGI SRWPSRKINK VNRSLSDRFS TRSRGSTKIR  600
PVNWVSRCCS VT*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.10.0Nin-like family protein