PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_08.3395
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 158aa    MW: 17658.1 Da    PI: 5.1983
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_08.3395genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.51.3e-4461051100
                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 
                                    +Ca+Ck+lrr+CakdC++ap fp+++p+kfa+vhk+FGasnv+k+l+++p ++r+da+sslvyeA+ar+rdPvyG+vg i
  evm.model.AsparagusV1_08.3395   6 PCASCKLLRRRCAKDCIFAPFFPSDDPQKFAIVHKVFGASNVSKMLQEVPFHQRSDAVSSLVYEANARMRDPVYGCVGAI 85 
                                    7******************************************************************************* PP

                         DUF260  81 lklqqqleqlkaelallkee 100
                                    + lq+q++ql+ +la +++e
  evm.model.AsparagusV1_08.3395  86 TFLQNQVSQLQMQLAIAQAE 105
                                    ***************99987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    
MGGNSPCASC KLLRRRCAKD CIFAPFFPSD DPQKFAIVHK VFGASNVSKM LQEVPFHQRS  60
DAVSSLVYEA NARMRDPVYG CVGAITFLQN QVSQLQMQLA IAQAEILCIQ MQQDQHTAND  120
PDQLGFEEEE EKCFLLHDNG FSVAQVQETL KRESLWT*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-72LBD family protein