PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_07.421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 181aa    MW: 19459.2 Da    PI: 8.7195
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_07.421genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77e-42181171100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i+
  evm.model.AsparagusV1_07.421  18 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPEPQRADAANSLVYEANVRLRDPVYGCMGAIS 98 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lqqq++ l+aela+++ e
  evm.model.AsparagusV1_07.421  99 ALQQQVQALEAELAMVRGE 117
                                   **************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    
MSRRNLLGPV GTLNTITPCA ACKLLRRRCA QECPFSPYFS PHEPQKFASV HKVFGASNVS  60
KMLMEVPEPQ RADAANSLVY EANVRLRDPV YGCMGAISAL QQQVQALEAE LAMVRGEILK  120
HKYRQSNAGI NIPAALLASI PTPPPPPSVQ AASSSSSMYT PASNSTDYSS ITNENVTYFG  180
*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-67LBD family protein