PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_07.380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 212aa    MW: 23168.2 Da    PI: 4.6438
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_07.380genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.41.1e-42391381100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C+++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i 
  evm.model.AsparagusV1_07.380  39 PCAACKILRRRCVDKCVLAPYFPPTEPLKFTTAHRVFGASNIIKFLQELPENQRADAVSSMVYEANARIRDPVYGCAGAIC 119
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q+++l+a+la++++e
  evm.model.AsparagusV1_07.380 120 QLQKQVNELQADLARAQAE 138
                                   **************99987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    
MESSLDTTIT TTTFNCNSSS SGSPSPTSSP PPPSIVVSPC AACKILRRRC VDKCVLAPYF  60
PPTEPLKFTT AHRVFGASNI IKFLQELPEN QRADAVSSMV YEANARIRDP VYGCAGAICQ  120
LQKQVNELQA DLARAQAELI NMQTQHANLV ALICMEMANS QQNHQQLQNC APPSSINNPM  180
DCSPQSFLVE PESFFLDESN QGCLWEEPLW T*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-68LBD family protein