PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_07.238
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family EIL
Protein Properties Length: 280aa    MW: 31407.6 Da    PI: 7.8467
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_07.238genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3191.19.7e-591420789285
                                   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--H CS
                          EIN3  89 dsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgve 169
                                   + Lr+W +e v f r+gp +i+ y++     ++ +s +  +   ++sl+el D+tlgS+ sal++ cdppq+ fpl+kg +
  evm.model.AsparagusV1_07.238  14 SALRGWLQETVCFSRAGPEQIARYNS---NYNE-DSTN-YNDTGPKSLMELSDATLGSMISALIRYCDPPQKMFPLKKGAP 89 
                                   579*********************43...2333.3333.4899************************************** PP

                                   HHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHH CS
                          EIN3 170 pPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvl 250
                                   pPWWPt +e+ww+  g+++dqg+ pykkphdlkkawk ++L+avikh+ p+ ++i    rqsk+lq++msake  +++  +
  evm.model.AsparagusV1_07.238  90 PPWWPTAEEDWWAPSGFPTDQGPVPYKKPHDLKKAWKAGILAAVIKHLMPKTSRIAAVIRQSKRLQHRMSAKENKIWMGFV 170
                                   ********************************************************************************* PP

                                   TTTTT-S--XXXXXX..XXXXXXXXXXXXXXXXXXXX CS
                          EIN3 251 nqeekecatvsahss..slrkqspkvtlsceqkedve 285
                                    +ee+++ +  ++s     ++qs+++ +s  + e + 
  evm.model.AsparagusV1_07.238 171 AKEEEMYVKSLQDSGedANKQQSEDYMASMMNLEFNS 207
                                   ****999888888554455557776666665555444 PP

Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    
MTTAPSSPRP RTPSALRGWL QETVCFSRAG PEQIARYNSN YNEDSTNYND TGPKSLMELS  60
DATLGSMISA LIRYCDPPQK MFPLKKGAPP PWWPTAEEDW WAPSGFPTDQ GPVPYKKPHD  120
LKKAWKAGIL AAVIKHLMPK TSRIAAVIRQ SKRLQHRMSA KENKIWMGFV AKEEEMYVKS  180
LQDSGEDANK QQSEDYMASM MNLEFNSCDQ SSRLQGFGMV DNLSNFNYNL VGVGVNNSLV  240
YQPQPAMAVP EETNQSRVQC RERCGFAAPS PFFIEDYGF*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.16e-58EIL family protein