PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_06.1073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 191aa    MW: 20980.7 Da    PI: 8.4882
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_06.1073genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601056.4e-33251241100
                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 
                                    aCaaCk++r+kC++ Cv+apyfp   +++f  ++k+FG+sn+ k+ + +p  +r   ++s+vyeAe r  +Pv G++g +
  evm.model.AsparagusV1_06.1073  25 ACAACKHQRKKCVDTCVFAPYFPPGLAREFHRAQKVFGVSNMAKMAAGIPVGHRGLFFESVVYEAELRYLNPVTGCAGQV 104
                                    7******************************************************************************* PP

                         DUF260  81 lklqqqleqlkaelallkee 100
                                     +l++q ++l++e+++l+e+
  evm.model.AsparagusV1_06.1073 105 DRLRRQNCELRHEVEVLREK 124
                                    **************999876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    
MLNDANSVPP PLPPPPQPVP GKSPACAACK HQRKKCVDTC VFAPYFPPGL AREFHRAQKV  60
FGVSNMAKMA AGIPVGHRGL FFESVVYEAE LRYLNPVTGC AGQVDRLRRQ NCELRHEVEV  120
LREKVRVYED FFHNNNGNGN GFVYNISDQH PHDNCANLNA VTNNSNSNNV VFYSAGSTLL  180
NGERGKRADS *
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-24LBD family protein