PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_05.418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 212aa    MW: 23035.3 Da    PI: 9.7554
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_05.418genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.81.4e-41421411100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++p  +r da++slvyeA++r+rdP+yG++g il
  evm.model.AsparagusV1_05.418  42 PCAACKLLRRRCAQECIFAPYFSPHEPQKFAAVHKVFGASNVSKMLMEVPGPQRADAANSLVYEANVRLRDPIYGCMGAIL 122
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lqqql++l++ela++++e
  evm.model.AsparagusV1_05.418 123 ALQQQLHSLEVELAAVRAE 141
                                   **************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    
MSTTRFEEVS KKIKREADVV ASDRMSRRNL LGPVGTLNTV TPCAACKLLR RRCAQECIFA  60
PYFSPHEPQK FAAVHKVFGA SNVSKMLMEV PGPQRADAAN SLVYEANVRL RDPIYGCMGA  120
ILALQQQLHS LEVELAAVRA ETLKHKFRQN SASINIPSSL IAPNSSEASA AARPLPPPQA  180
ASSSSSMYTP LSNSRDYSSI SNEHVAFFGQ R*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-74LBD family protein