PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_05.197
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 110aa    MW: 12161.4 Da    PI: 4.6613
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_05.197genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26046.51.1e-1426241101
                        DUF260  41 nvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                                   ++l + ++lp e+r +a+++++ eA +r+rdPvyG+vgvi+ lqqq+  +++ela++++++
  evm.model.AsparagusV1_05.197   2 KILDIKQNLPVEQRGQAADAIASEAYWRVRDPVYGSVGVISLLQQQIYAVQSELAETQAQI 62 
                                   57888999************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    
MKILDIKQNL PVEQRGQAAD AIASEAYWRV RDPVYGSVGV ISLLQQQIYA VQSELAETQA  60
QIALHSAQQQ QHRQQNQVQL ENHPYGLDDS QQFGLDQGPS GPQNPPNFP*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-15LBD family protein