PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_04.2874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 233aa    MW: 25398.5 Da    PI: 6.4987
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_04.2874genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.5e-44281271100
                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 
                                    +CaaCk+lrrkC++dCv+apyfp ++p+kf nvhk+FGasnv+k+l++l++++reda++sl+yeA++r++dPvyG+vg+i
  evm.model.AsparagusV1_04.2874  28 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVNVHKVFGASNVTKILNDLDRDQREDAVNSLAYEADMRLKDPVYGCVGII 107
                                    7******************************************************************************* PP

                         DUF260  81 lklqqqleqlkaelallkee 100
                                    + lq+ql+ql+ +l l+k+e
  evm.model.AsparagusV1_04.2874 108 SILQHQLRQLQLDLTLAKAE 127
                                    **************999886 PP

Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    
MMMPSSSAFP HSTALSSLGS SSTMTSSPCA ACKFLRRKCQ PDCVFAPYFP PDNPQKFVNV  60
HKVFGASNVT KILNDLDRDQ REDAVNSLAY EADMRLKDPV YGCVGIISIL QHQLRQLQLD  120
LTLAKAELSK YQNQNITSPS NYPHFLMSRE SSGSAGYYQQ PQQHMIMLRS YEVELATTAT  180
RMGVNGEYDA PAMAGNGTSA GSVGACGGQF FKTTANGDAR EERHSSEVCE DQ*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.31e-54LBD family protein