PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_04.1379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family Nin-like
Protein Properties Length: 923aa    MW: 103443 Da    PI: 6.0323
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_04.1379genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.31.5e-28600650252
                         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                    ek++sl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  evm.model.AsparagusV1_04.1379 600 EKTVSLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 650
                                    799**********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    
MNLNSAMEDS GARKTECSPE RSLSDSAVDF DLMDEILSGD CWLQTPDYSD LFQPSGSAPS  60
PFFPLLDISN HGSNAILAET DNREETPPNS SSEQGLNLLV QPRSPTPPLK DRLIHALKCI  120
KESQRDCDVL VQIWVPIRRG GRHFLSTSGQ PFWLDAENQG LDSYREVSTS YRFSAEENSN  180
EAVGLPSRVF LGRVPEWTPD VRYFSSYEYP RVDHAQRYNV CGTIALPVFE RDSRSCLGVL  240
EVVLTRQKIN YSSDLESICS ALQAVDLRSY DVLSVPRVKV SNNSYQAALP EIQQVLKVVC  300
ETHNLPLAQT WITCIQQDKQ GCRHSNENYK ECVSTVDVAC YVNDPSMLSF HEACSEHHLF  360
RGQGVAGKAF TTNQPCFSPD VTSFTKTEYP LSHHAKLFNL RGTVAIRLRS FHTGKADFVL  420
EFFLPVNCIE SEEQRLMLNS LSTTIQQVCQ SLRVVTAKEL EDEAMLEVDE SYPSDFLFDE  480
SFSEGGQGID ERNVFSSGSP STGISIEVPS LIVNVTEVQE KEEHGLLPSS THLEFRKQDI  540
EELKVTNNWN TSESGLSKSR IFYESEQLPQ STADEKDNVC SDITLPQARK TTEKRRAKTE  600
KTVSLQVLRQ YFAGSLKDAA KSIGVCPTTL KRICRQHGIT RWPSRKIKKV GRSLKKLQVV  660
IDSVQGAEGT FQFSSVYENF AKISSPNKEL LEKQTDHPGS SNTLQQLEGR FSSHTSASNS  720
LSSASCSQSS SSSLGCSSGS KQLIHTSQPA IKHEVPTEEN KIENSEVELW SSSREPPRPL  780
VRSQSHHAFV HHPTLENSSL LTKRSQSHRA LAEHPSLENP SQLQKRSEVY KIKAIYREEK  840
VRFRLQPDWG FRELKQETVK RFHITDVNSV DIKYLDDDSE WVLLTCDADL QECIDVYKSS  900
NSGVIKMSVH HVASAVVTVN LC*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein