PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_03.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family Nin-like
Protein Properties Length: 262aa    MW: 30956.4 Da    PI: 6.1927
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_03.30genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.18.7e-29113163252
                       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                  ek++++e++skyF++pi++AA+eL v+lT+LK++CR++GI+RWPhRk+ksl
  evm.model.AsparagusV1_03.30 113 EKNLTFEEVSKYFYMPITQAARELHVGLTLLKKKCRELGIPRWPHRKMKSL 163
                                  79***********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    
MDIKQLDNWV GYEGQMTAPD YLELSGFPHW RDWQLDFPVV EEDVVEAVPL MQRYQWEPLF  60
PPHDDLFEVE FNTLLDEENH RPWESTHMTK KRNLIEENNG KEKELCIRGS RDEKNLTFEE  120
VSKYFYMPIT QAARELHVGL TLLKKKCREL GIPRWPHRKM KSLQALIKNV QELEREEGEA  180
GEVQLRSTIE ILEQEKKLME KKPDMKLEEK TKRLRQACFK ANYKKRRLTL MSAAADQEQH  240
SPASLCNGSV LEYFNGQTKR F*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-44Nin-like family protein