PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_03.180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family EIL
Protein Properties Length: 247aa    MW: 28156.7 Da    PI: 5.8247
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_03.180genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN325.81.8e-0843812765
                                  XXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                          EIN3 27 dkeaatgakksnksneqarrkkmsraQDgiLkYMlkeme 65
                                    e + + +++  s+++arr+k+ raQ ++LkYMlk+m+
  evm.model.AsparagusV1_03.180 43 LDEFQGERAQEPVSSQRARRRKTYRAQNSVLKYMLKMMQ 81
                                  34444555556678899*********************5 PP

2EIN3187.71.1e-5780200139258
                                   S-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT.--TT--.-----GGG--HHHHHHHHHHHHHHTG CS
                          EIN3 139 lqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg.lskdqgtppykkphdlkkawkvsvLtavikhms 218
                                   +qD+tlgSLLsal qhcdppqr fplekg++pPWWPtG e wwg +g  +k qg+ppy+kphdlkkawk+s+L+avikhms
  evm.model.AsparagusV1_03.180  80 MQDSTLGSLLSALLQHCDPPQRMFPLEKGLAPPWWPTGLETWWGIQGdHAKAQGPPPYRKPHDLKKAWKLSLLAAVIKHMS 160
                                   59*********************************************999******************************* PP

                                   GGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S- CS
                          EIN3 219 ptieeirelerqskylqdkmsakesfallsvlnqeekeca 258
                                   p+++++r+l++ sk+lq+k s++e  ++ +vlnqee ++a
  evm.model.AsparagusV1_03.180 161 PNLDQLRNLVLHSKRLQNKTSSRENETWTRVLNQEETLLA 200
                                   ************************************9775 PP

Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    
MNPAGHPYDT NAALQPEEDD GDGDDNDIVE LLEKRMHKGQ VLLDEFQGER AQEPVSSQRA  60
RRRKTYRAQN SVLKYMLKMM QDSTLGSLLS ALLQHCDPPQ RMFPLEKGLA PPWWPTGLET  120
WWGIQGDHAK AQGPPPYRKP HDLKKAWKLS LLAAVIKHMS PNLDQLRNLV LHSKRLQNKT  180
SSRENETWTR VLNQEETLLA IDDKERNDEI EGNDSALSLS EIDVSLIDQR SIDELIMSMH  240
HNIQNT*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.13e-51EIL family protein