PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_02.565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family Nin-like
Protein Properties Length: 814aa    MW: 90378.5 Da    PI: 6.2264
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_02.565genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK924.6e-29507557252
                        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                   ek+isl+ l+kyFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  evm.model.AsparagusV1_02.565 507 EKNISLSILQKYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 557
                                   89***********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    
MDGFNPMDCG DDPFNLSALL SLDNYPELCS PLDYAAPPYS YSAFQQISSN WASSDIDTLA  60
SASANASDES MISIIPKYMP NNSLAERLLR ALSLFKESSG GGILAQVWMP MKHSNGYILS  120
TSEQPFLLDQ ILAGYREVSR AFTFSVEEAP SSFPGLPGRV FISGLPEWTS NVVYYNNLEY  180
LRGEYALVHK VRGSLALPIF YPKERSCCAV LELVTTKEKT DFDMEMDSVC NALQAVELRS  240
IKGQIYQQPP TKKQKSAFNE ILDVLRACCH AHMLPLALTW IPFDSTKEVV CELNSSLSKK  300
NLLYVEESAC YVNDTRMKGF VHACVEHCLE KEQGIAGKAL LSNHPFFSPD VKSYNIREYP  360
LAHHARKYGL NAAVAIRLRS TLTGDDDYIL EFFLPLNCRG SSEQQELLNN LSSTMQRICR  420
SLRTVSDAEV VISDSLKRDI HKQAGNNSSS PEISIKNSQQ MDSDNEVFTD FAIEDPNKKL  480
SEQGDANSEQ FKSGSSRQPE KKRSTTEKNI SLSILQKYFS GSLKDAAKSI GVCPTTLKRI  540
CRQHGISRWP SRKINKVNRS LKKIQTVIDS VQGVEGALKY DPTSRCLVAS VSTEKSNTTS  600
LEKFKTFEQV TAKSSNLMGI DDINTKTDTD TIKEHSHPTY SSMTDSSSGS ASSIPTFQKN  660
SNDKVLAYDI DNGSAITVKA TYREDTVRFK FIPIMGCLQL LEEIGKRYKL SIGTFQLKYM  720
DDEEEWVMLS SDADLLECVE VLESIGSRNL KLLVRDVQCR VIYLGLRPEP EPVSGPDPAK  780
LELGPGTGKA RILKLNRAPD PSSSRLVEDG RAG*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.10.0Nin-like family protein