PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_02.1250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family EIL
Protein Properties Length: 569aa    MW: 65008.1 Da    PI: 5.9519
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_02.1250genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3395.76.2e-121454096354
                                    XXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                           EIN3   6 rmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpve 85 
                                    r wkd  +lkrl+++k+  + +    + + k  +s+e ar+kk sraQD +L+YMlk+me cna+GfvYgiipe+gkpv+
  evm.model.AsparagusV1_02.1250  45 RIWKDTLKLKRLRRNKLL-MSETGL-IAEPKPAQSKELARKKKFSRAQDTVLRYMLKMMESCNAEGFVYGIIPENGKPVT 122
                                    89********99999985.644444.9999************************************************** PP

                                    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TT CS
                           EIN3  86 gasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfple 165
                                    gas++Lr+WWkekv+fdrngpaa++ky a+++++s  +++++   +   +l+e+qDTtlgSLLsalmqhc+ppqrrfple
  evm.model.AsparagusV1_02.1250 123 GASENLRGWWKEKVRFDRNGPAAVAKYSAEHAAASALDEQKA-DINIRVKLHEIQDTTLGSLLSALMQHCEPPQRRFPLE 201
                                    *******************************99998888877.7788899****************************** PP

                                    T--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHH CS
                           EIN3 166 kgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfa 245
                                    kg +pPWWP  +++ww elg+++d g+ppykkphdlkk+wkv+vLtavikh+sp+ ++ir+l  qsk+lqdk +akes  
  evm.model.AsparagusV1_02.1250 202 KGSPPPWWPDLTDDWWIELGFPTDKGKPPYKKPHDLKKVWKVAVLTAVIKHISPNTDKIRQLIKQSKCLQDKLTAKESLL 281
                                    ******************************************************************************** PP

                                    HHHHHTTTTT-S--XXXXXX....XXXX....XXXXXXXXXXXXXXXX...XXXXXX.XXXXXXXXXX.........XXX CS
                           EIN3 246 llsvlnqeekecatvsahss....slrk....qspkvtlsceqkedve...gkkeskikhvqavktta.........gfp 305
                                    +++vl qe++ +++ +++ +     ++k     + ++  sc+ ++dve    +++sk  + + +k+++         +++
  evm.model.AsparagusV1_02.1250 282 WSAVLDQEDRCYRQKHPEFQvpklPVNKgnncLASSFSSSCS-DYDVEyynLREDSKDDEDSGKKQKNkgikiegegSMN 360
                                    ******************444567444422223344555555.99***99944444433333333333578899999999 PP

                                    XXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
                           EIN3 306 vvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                                     ++kr +  + + ++++      c++  ++++e  ++fad+  ++ ++y
  evm.model.AsparagusV1_02.1250 361 HAHKRAAAIMPQDQYQQPFPLFICENIGCPRHEFCNGFADRGTRNIHQY 409
                                    ******999999***99999************************99987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    
MEGQNQEIPD IPYAMLLPLP PPNMDYNDDD EDGELSEDEE TLVCRIWKDT LKLKRLRRNK  60
LLMSETGLIA EPKPAQSKEL ARKKKFSRAQ DTVLRYMLKM MESCNAEGFV YGIIPENGKP  120
VTGASENLRG WWKEKVRFDR NGPAAVAKYS AEHAAASALD EQKADINIRV KLHEIQDTTL  180
GSLLSALMQH CEPPQRRFPL EKGSPPPWWP DLTDDWWIEL GFPTDKGKPP YKKPHDLKKV  240
WKVAVLTAVI KHISPNTDKI RQLIKQSKCL QDKLTAKESL LWSAVLDQED RCYRQKHPEF  300
QVPKLPVNKG NNCLASSFSS SCSDYDVEYY NLREDSKDDE DSGKKQKNKG IKIEGEGSMN  360
HAHKRAAAIM PQDQYQQPFP LFICENIGCP RHEFCNGFAD RGTRNIHQYS CQYRASSSVN  420
PGIHATAGFA PYAYQYNQLN QSQINDNQQI GNLMNQYDTN VNDRTMVMPT NLSSNFIQEK  480
MAHVQEPSFH QNAMMNNQNG YYIPEYNMES NVYEQAQEQE QSLMFENQNN NFNEEFGGMR  540
TVGFYGMKYT DAMTKLDGLD EWFGSGSG*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.14e-95EIL family protein