PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_01.2950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family Nin-like
Protein Properties Length: 898aa    MW: 98962.3 Da    PI: 5.8685
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_01.2950genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK894e-28547598152
                         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                    aek+isle+l++yFs+++kdAAk Lgvc+T++KriCRq+GI+RWP+Rki+++
  evm.model.AsparagusV1_01.2950 547 AEKTISLEVLHRYFSGSLKDAAKALGVCPTTMKRICRQHGISRWPSRKINKV 598
                                    589***********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 898 aa     Download sequence    
MAERGAQPHP QIQSNGAREL MDFDAELDLA SWPLPSPSPP RPPSPVWWFD DGGSPVADFW  60
SAFAARGAND SDVANGNITQ EDVKKRKPQP EMCEDDSDDY CFIRKRMTQA LRYLKESAGQ  120
QILVQVWAPV KNGNKYVLTT SGQPFVLDPH SLGLHQYRTV SMTYVFSADG DGDGDLGLPG  180
RVFRGKMPEW TPDVQFYSSK EYPRLVHARN FDVRGTLALP VFEPSGHSCV GVVELIMTSR  240
KINYAPEVDK VCKALEAVNL KSYDISDIPS VQICNEGRQN AFAEILEILT TICEEHKLPI  300
AQTWVPCRHR NVLTYGGGSQ KSCSSFDGSC MGQVCMSTSD VAVYVIDPQM WGFRDACVEH  360
HLQKGQGVAG RAFESRSSCF SRDITQFSKT EYPLVHYARL FNLAGSLAVC LQSVHTGNDD  420
YILEFFLPPG CRDPVQQKVL LDSILNLMKQ CFRNLRISVN EDIQEGKSPG FFDVSETGNR  480
EHEPGLALGQ SCSTHVNANS PKDNPAQVEN LVPNRAKAVN TERNYTESAP SLVNLSAKKP  540
ERKRGKAEKT ISLEVLHRYF SGSLKDAAKA LGVCPTTMKR ICRQHGISRW PSRKINKVNR  600
SLSKLKRVIE SVQGAEGAFN LPSLSCQLPL AVSLDGCRHG GDGEPLSLQH AELDKDSLPH  660
KSLQSDDQSN NKKAQQETIR AHADSNVEPD KDSSKTISSG EGSSEAATSQ ESCEEVNVTD  720
SPNLNNGFNV NGFLGFSNPM PDASIEEPQP MLGRVLIEDS GSSKDLKNLF SSIVEGCHYE  780
NSVLYTNHEP SHPTEVQGLR TVTIKASYRE DIVRFRLPGS AGMMELSEEV AKRLKLEVGT  840
FDIRYLDEDQ EWVMLSCDAD LKECIEISRL SGLHIIRLSV HDVAPLLGSS CGSSAGQ*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein