PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_01.2949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 163aa    MW: 18699.5 Da    PI: 5.0047
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_01.2949genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601216.7e-38141141101
                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 
                                    +Ca+C++l rkC+ dC+lapyfpa++++kfa+vhk+FGasnv+k+l+ +++  +eda++s+vyeA ar+r+PvyG++  i
  evm.model.AsparagusV1_01.2949  14 PCAGCRMLHRKCSYDCMLAPYFPANETEKFAVVHKVFGASNVIKMLQMVDDVWKEDAVKSMVYEAYARIRNPVYGCTFAI 93 
                                    7******************************************************************************* PP

                         DUF260  81 lklqqqleqlkaelallkeel 101
                                    + lq+ +e+l+++l+++++++
  evm.model.AsparagusV1_01.2949  94 SYLQKCVEELEEQLKTTQQQI 114
                                    *****************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    
MDPRAQPQVK REVPCAGCRM LHRKCSYDCM LAPYFPANET EKFAVVHKVF GASNVIKMLQ  60
MVDDVWKEDA VKSMVYEAYA RIRNPVYGCT FAISYLQKCV EELEEQLKTT QQQILKSQEE  120
IGQLSFALDS VYLPVNNMFD ERISSDNTTI HDTAFTIPMD YY*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-35LBD family protein