PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_01.2676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 145aa    MW: 15954.1 Da    PI: 7.44
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_01.2676genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26066.94.6e-212541466
                         DUF260 14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAe 66
                                   ++C++apyfp e+p+kfa vhk+FGasnv+kll++l +++reda++sl+yeAe
  evm.model.AsparagusV1_01.2676  2 PGCIFAPYFPPEEPQKFASVHKIFGASNVTKLLNDLLPHQREDAVNSLAYEAE 54
                                   78**************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    
MPGCIFAPYF PPEEPQKFAS VHKIFGASNV TKLLNDLLPH QREDAVNSLA YEAEDALSTA  60
ASEPSPSSRG RSTVSRRSWT PPMPTSSATS SDMLIVISQL MVVSFTPTDV SCLQRILFYC  120
FLNVHDWSRS TSRKEKKQKE GIGD*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.23e-33LBD family protein