PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc07121.1.g00010.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 9810.91 Da PI: 10.5519 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.1 | 4e-08 | 2 | 37 | 12 | 47 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++ + +++G+g+W++I+r + Rt+ q+ s+ qky Zpz_sc07121.1.g00010.1.sm.mk 2 FLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 37 777899***************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.11 | 1 | 42 | IPR017930 | Myb domain |
CDD | cd00167 | 6.56E-6 | 1 | 38 | No hit | No description |
SuperFamily | SSF46689 | 2.22E-10 | 1 | 43 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-6 | 2 | 37 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.1E-11 | 2 | 40 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.3E-6 | 2 | 37 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
LFLLGLEKYG KGDWRSISRN FVISRTPTQV ASHAQKYFIR LNSMNRERRR QSIHDITSVN 60 NGDASAAQGP ITGSANVTGW TEKSDDW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc07121.1.g00010.1.sm.mk |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679443 | 3e-71 | HF679443.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB37 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025823483.1 | 4e-46 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 1e-40 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A3L6PSD7 | 6e-45 | A0A3L6PSD7_PANMI; Uncharacterized protein | ||||
TrEMBL | A0A3L6QCW8 | 7e-45 | A0A3L6QCW8_PANMI; Uncharacterized protein | ||||
TrEMBL | I1PI25 | 1e-45 | I1PI25_ORYGL; Uncharacterized protein | ||||
STRING | Pavir.Gb00055.1.p | 1e-45 | (Panicum virgatum) | ||||
STRING | OPUNC04G27130.1 | 2e-45 | (Oryza punctata) | ||||
STRING | ORGLA03G0402100.1 | 2e-46 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9466 | 30 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 6e-43 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|