PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04425.1.g00050.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 360aa    MW: 41084.8 Da    PI: 9.9942
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04425.1.g00050.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.1e-14453148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                                  r+rW +eEd  l  +v+q+G++ W++++++m+  + R +k+c +rw +yl
  Zpz_sc04425.1.g00050.1.sm.mk  4 RQRWRPEEDAVLRAYVRQYGPREWHLVSQRMNvaLDRDAKSCLERWKNYL 53
                                  89**********************************************97 PP

2Myb_DNA-binding36.41.2e-1159103147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Zpz_sc04425.1.g00050.1.sm.mk  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                                   6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.82153IPR017930Myb domain
SMARTSM007171.3E-11355IPR001005SANT/Myb domain
SuperFamilySSF466893.24E-21498IPR009057Homeodomain-like
CDDcd001671.27E-7653No hitNo description
Gene3DG3DSA:1.10.10.604.2E-20660IPR009057Homeodomain-like
PfamPF139214.8E-13767No hitNo description
PROSITE profilePS5129423.37554108IPR017930Myb domain
SMARTSM007172.8E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-1561102IPR009057Homeodomain-like
CDDcd001673.97E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MKERQRWRPE EDAVLRAYVR QYGPREWHLV SQRMNVALDR DAKSCLERWK NYLRPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE LRDSRRPPPE  120
PSPDERGRYE WLLENFAEKL VNERQTAPLL MAAPGLPPWL SSNAGPAAIT QPPSPSVTLS  180
LASAAVAAPS PSAVPHGAPW MPPDRAAAEA FGFASPQALP GGAPPNPGMA VVEGQALAEL  240
VECCRELEEG QRAWAAHRRE AAWRLKRVEQ QLEAEREMRR REMWDEFEAK MRAMRVEQAA  300
AAERVEREYR EKAAELRRDA QAKEEKMAEQ WAAKHARVAK FLEQVGGCHP PRPWSSAEMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-157101798MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-157101798C-Myb DNA-Binding Domain
1msf_C5e-157101798C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. Interacts directly with asymmetric leaves 2 (AS2) to repress the knox homeobox genes. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:9655808}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc04425.1.g00050.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1264890.0AF126489.1 Zea mays rough sheath2 protein (rs2) gene, complete cds.
GenBankAF1434470.0AF143447.1 Zea mays rough sheath 2 (rs2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105509.11e-166protein rough sheath 2
SwissprotQ9S7B21e-167RS2_MAIZE; Protein rough sheath 2
TrEMBLA0A317YB851e-167A0A317YB85_MAIZE; Protein rough sheath 2
STRINGGRMZM2G403620_P011e-165(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.12e-88MYB family protein