![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc03786.1.g00020.1.am.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 196aa MW: 21882.5 Da PI: 8.9019 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.5 | 3.5e-14 | 14 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + +WT+eEd l + v++ G+ W+ Ia+ ++ gR++k+c++rw ++l Zpz_sc03786.1.g00020.1.am.mk 14 KTPWTAEEDAALRREVRRRGPQKWAVIAAALP-GRSAKSCRLRWCQHL 60 579*****************************.***********9986 PP | |||||||
2 | Myb_DNA-binding | 50.7 | 4.1e-16 | 68 | 109 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++T+eEd ++v+ + +G++ W+tIar++ gR+++ +k+rw++ Zpz_sc03786.1.g00020.1.am.mk 68 PFTPEEDARIVEQQRVHGNK-WATIARYLR-GRSDNAVKNRWNS 109 79******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.595 | 9 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.59E-29 | 12 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-13 | 13 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.7E-14 | 14 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-21 | 16 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.15E-12 | 16 | 60 | No hit | No description |
SMART | SM00717 | 1.3E-12 | 65 | 113 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.373 | 67 | 115 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-19 | 68 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.50E-10 | 68 | 108 | No hit | No description |
Pfam | PF00249 | 2.7E-13 | 68 | 109 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MAAEGGEGMA DFKKTPWTAE EDAALRREVR RRGPQKWAVI AAALPGRSAK SCRLRWCQHL 60 APELDCRPFT PEEDARIVEQ QRVHGNKWAT IARYLRGRSD NAVKNRWNSA LRRLQEQGGG 120 RDHATEGAEA DDQQPPAPVY LELFPVRGGG LREATTSGRL AVREEQDDHV PSTSRTLGSQ 180 RWSEAELALR LGPVQP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-30 | 8 | 113 | 1 | 106 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc03786.1.g00020.1.am.mk |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004974756.1 | 3e-75 | transcription factor MYB1 | ||||
Swissprot | Q9SN12 | 1e-41 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | K3YND5 | 8e-74 | K3YND5_SETIT; Uncharacterized protein | ||||
STRING | Si015776m | 1e-74 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 5e-44 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|