PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02889.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Nin-like
Protein Properties Length: 390aa    MW: 42146.8 Da    PI: 4.407
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02889.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK59.18.1e-19301351252
                        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                   +++++  d++ yF+lp+++A+k+L+vc TvLK   R++G+kRWP+R i+++
  Zpz_sc02889.1.g00040.1.sm.mk 301 TSKLERRDIACYFHLPMEEACKKLQVCGTVLKGVSRKFGLKRWPYRTINKI 351
                                   678999******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.88291372IPR003035RWP-RK domain
PfamPF020423.0E-17304351IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MAANGDNNDH GAEGQWLFDP LLVPDDLDDV MHLLNVPADD DQYSPPPPAS TQNVATDGSY  60
SGNSLDGTAM AGNVGAYSSV DSTAHPAAVT AMAGGSSTSA HQDVGASSSY VHQGVLDCTG  120
CQMLREIMHI KGLETTKLCI HGVPGLFYHA TLEVYHANNE GLALEPTHQS FVDFIARDYA  180
WVKHYLIEYA QKRAAGGYTV VHDSTSDFLD VLCTSMAGVC VHADDNGDVA APAEAENGVA  240
VEEQIVPADA GDAVQPMIAQ EEILPDEPGP SELRNDAVDD QEEQVVQPHA RSTLAIQRER  300
TSKLERRDIA CYFHLPMEEA CKKLQVCGTV LKGVSRKFGL KRWPYRTINK IDNKIAKLRE  360
NGDGSAESMA EIQKLTDSRR EIIDGPSEEI
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02889.1.g00040.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021321666.17e-84uncharacterized protein LOC8084238
TrEMBLA0A368QD383e-96A0A368QD38_SETIT; Uncharacterized protein
STRINGSi025242m2e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-10RWP-RK domain-containing protein