PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02580.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 824aa    MW: 90457.5 Da    PI: 9.732
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02580.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.3e-15480527148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd +l+ ++++ G  +W++ ++  g+ R++k+c++rw +yl
  Zpz_sc02580.1.g00020.1.am.mk 480 KGSWTPEEDMRLIAYIQRCGHANWRALPKQAGLLRCGKSCRLRWINYL 527
                                   799*****************************99************97 PP

2Myb_DNA-binding53.17.6e-17533578148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Zpz_sc02580.1.g00020.1.am.mk 533 RGNFTVEEEETIIKLHAMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 578
                                   89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-22471530IPR009057Homeodomain-like
PROSITE profilePS5129413.766475527IPR017930Myb domain
SuperFamilySSF466892.96E-29477574IPR009057Homeodomain-like
SMARTSM007176.2E-12479529IPR001005SANT/Myb domain
PfamPF002497.5E-14480527IPR001005SANT/Myb domain
CDDcd001672.56E-9482527No hitNo description
PROSITE profilePS5129425.265528582IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-26531581IPR009057Homeodomain-like
SMARTSM007172.7E-15532580IPR001005SANT/Myb domain
PfamPF002493.3E-15533578IPR001005SANT/Myb domain
CDDcd001673.18E-11535578No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 824 aa     Download sequence    Send to blast
MDRYIEFSDN KENGVTRAET RRLVDTPTGD YAEANGLRSR SRPNRNWKPR ILCNISHPAV  60
SHLRAGAACQ SIGLARPTEC SAHVSPAPRL SLQGDADVMG LSVRRESSSQ LAAAARDDGS  120
VRGFTPASET AQTPAAFGVA LYHPRARAWR RSYHPRVLLQ FCKAEPPFTM TMRASKRAAH  180
PTNCRASKRA RKVARQDGVA GYGFRGAVEE RRRILPTCTK KPLLNIIPVS EINKLAFAHT  240
PVMSDERTLM LRPFHPSDTI AVRSNVSPHR VSATRYKSNR DNVRDLQDER KQACVKGPRD  300
RQRRRGIQLR RFDGQASTPP PSPNRDHTSP HEIAAAELDA PGVRAAEING HATPAGPSVL  360
LGIRGGCKRR RSVRLAPSWS LVRRVCAGGS VRAARATRPR PVSPVARVKG RDASLHRARV  420
YKYAAPCQCP GCSFLPHPVQ SSQHRRREQS ITRRRSLRCL WPGLMGKGRA PCCAKVGLNK  480
GSWTPEEDMR LIAYIQRCGH ANWRALPKQA GLLRCGKSCR LRWINYLRPD LKRGNFTVEE  540
EETIIKLHAM LGNKWSKIAA CLPGRTDNEI KNVWNTHLKK RVAPCGEQEH TAKKKKKKNS  600
AGAEATVPSP SPSPASSTTT TTNCSSGDSG EQQSNASCKE PDELDLKTLN IPTLDTAGFD  660
FDFDLDMLVD HPAPELHHPS LSVPTSPCAS STSPPAPATN VDGLLALPEI DIDQELWSII  720
DGDGACSFTE TPAPPCHGNA TEPDAATTSR EEDGKEWWLE NLERELGLWG PVEDYQCPAG  780
PLGLAEPDLP PMVQEQDPVT CYFQAGSTAA PLQGPELSSN QMTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2547858225128MYB TRANSFORMING PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1299304DRQRRR
2578597KKRVAPCGEQEHTAKKKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02580.1.g00020.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119601e-145AK111960.1 Oryza sativa Japonica Group cDNA clone:001-031-D02, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.15e-65myb domain protein 63