PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01939.1.g00120.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 507aa    MW: 54924.8 Da    PI: 8.3817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01939.1.g00120.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-14241288148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++eEd++l d + ++G g+W++ +++ g+ R +k+c++rw +yl
  Zpz_sc01939.1.g00120.1.am.mk 241 KGLWSPEEDQKLRDFIVRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 288
                                   678*******************************************97 PP

2Myb_DNA-binding52.88.9e-17295339248
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   g ++ eE+e   +++++lG++ W+ Iar+++ gRt++++k++w++yl
  Zpz_sc01939.1.g00120.1.am.mk 295 GMFSREEEETVMNLHAKLGNK-WSHIARHLP-GRTDNEVKNYWNSYL 339
                                   56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-20233291IPR009057Homeodomain-like
PROSITE profilePS5129414.645236288IPR017930Myb domain
SuperFamilySSF466897.11E-28239335IPR009057Homeodomain-like
SMARTSM007174.0E-11240290IPR001005SANT/Myb domain
PfamPF002491.2E-12241288IPR001005SANT/Myb domain
CDDcd001674.64E-10244288No hitNo description
PROSITE profilePS5129425.468289343IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-25292342IPR009057Homeodomain-like
SMARTSM007173.5E-14293341IPR001005SANT/Myb domain
PfamPF002494.3E-15295339IPR001005SANT/Myb domain
CDDcd001675.93E-12297339No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MRVETKHPKQ VRAGSHRDVK PGGSRLPDHD PKFIGPDAMH SRRMCKLSSD SCGDDDPGRP  60
EAEADAADPP LPLTPFWRFG AGQRLGSGPG SPCSCRSPAR ETEPNQRGGD GARQRRNAVF  120
AVRKSEIFLS FSATGGGLQD TEMFASSHQT GKIIRRSLIL KMPMRRRVAT ATAPWLRKQA  180
VDIYPIKPSA QPALAVLTPT QTDTTVQAHP QSLPFSSATP RSQSNHHPLA VPCAPKVQCR  240
KGLWSPEEDQ KLRDFIVRYG HGCWSALPAK AGLQRNGKSC RLRWINYLRP GLKHGMFSRE  300
EEETVMNLHA KLGNKWSHIA RHLPGRTDNE VKNYWNSYLK KRVEGGQASK CAADSDVSGS  360
TNTSETSQER LNRPASSESS SPVESSSADD SSCLTVTEPV APAAAAALRP HAPVLPRVMF  420
ADWLDMDYGT NLMAPGLDPA GVFDVMNGRS PTQGSVQVDG PCGAVDSLHG LDDGGVCWGF  480
DAAADQMDVQ GAGFCDLLSM SEFLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-262413447109B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01939.1.g00120.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915921e-129FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976342.11e-157transcription factor LAF1
TrEMBLA0A1E5W1231e-156A0A1E5W123_9POAL; Transcription factor LAF1
TrEMBLK3YDJ91e-156K3YDJ9_SETIT; Uncharacterized protein
STRINGSi012304m1e-157(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-54myb domain protein 18