PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc01417.1.g00180.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 114aa MW: 11909.5 Da PI: 8.5066 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 74.3 | 2.1e-23 | 67 | 114 | 2 | 49 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 C v+gC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsr+ Zpz_sc01417.1.g00180.1.sm.mk 67 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRY 114 **********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.1E-26 | 59 | 114 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 20.503 | 64 | 114 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 9.94E-22 | 65 | 114 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 6.9E-18 | 67 | 113 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MDWDLKVPAS WDLAELEHDA GAAAAPAAGP SGVHRVNAAV TTGGGVGAPR RPRPAGGGGA 60 GQQCPSCAVD GCKADLSKCR DYHRRHKVCE AHSKTPVVVV AGREMRFCQQ CSRY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 6e-17 | 67 | 114 | 6 | 53 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | SBP transcriptional regulator probably involved in the domestication of maize. Acts as a transcriptional repressor binding to a 5'-GTAC-3' motif. May repress the growth of lateral branches in length and numbers. {ECO:0000250|UniProtKB:Q49I55}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc01417.1.g00180.1.sm.mk |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP094913 | 9e-69 | FP094913.1 Phyllostachys edulis cDNA clone: bphyem212i14, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025876170.1 | 2e-39 | squamosa promoter-binding-like protein 18 isoform X3 | ||||
Swissprot | Q49I57 | 2e-36 | TGA1B_MAIZE; Teosinte glume architecture 1 | ||||
TrEMBL | A0A0F7LF00 | 9e-39 | A0A0F7LF00_ZEAMM; TGA1 (Fragment) | ||||
TrEMBL | A0A287ECT5 | 6e-38 | A0A287ECT5_HORVV; Uncharacterized protein | ||||
TrEMBL | K3YHM9 | 4e-37 | K3YHM9_SETIT; Uncharacterized protein | ||||
STRING | Si013747m | 6e-38 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1755 | 37 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 7e-23 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|