PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00760.1.g00090.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 166aa MW: 18880.3 Da PI: 5.0652 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.6 | 3.1e-50 | 20 | 150 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lppGfrFhP+dee++++yL +kv +++++ +i e++i+++ePw+Lp+++k +ekew+f+s +d+ky++g+r nrat++g Zpz_sc00760.1.g00090.1.sm.mk 20 LPPGFRFHPHDEEIITFYLIPKVLNSNFTS-VAIGEANINNSEPWELPTTAKMGEKEWFFYSLKDHKYQNGERINRATNAG 99 79*************************988.67***************989999*************************** PP NAM 82 yWkatgkdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrle 129 +Wkatgkdke++++ + +g+kktLvfy+grapkgekt W+mhey+le Zpz_sc00760.1.g00090.1.sm.mk 100 FWKATGKDKEIYQAsvmFPTIIGMKKTLVFYTGRAPKGEKTGWIMHEYQLE 150 *************64443445***************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.22E-52 | 17 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.16 | 20 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-25 | 21 | 149 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MDQQEQEGIR GGVDDGCLNL PPGFRFHPHD EEIITFYLIP KVLNSNFTSV AIGEANINNS 60 EPWELPTTAK MGEKEWFFYS LKDHKYQNGE RINRATNAGF WKATGKDKEI YQASVMFPTI 120 IGMKKTLVFY TGRAPKGEKT GWIMHEYQLE GIPEDLKEQE GACATN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swm_B | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swm_C | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swm_D | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swp_A | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swp_B | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swp_C | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
3swp_D | 1e-42 | 18 | 149 | 18 | 145 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc00760.1.g00090.1.sm.mk |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024983086.1 | 4e-66 | NAC domain-containing protein 92-like | ||||
Swissprot | Q9FLJ2 | 2e-61 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | A0A118JZL6 | 9e-65 | A0A118JZL6_CYNCS; No apical meristem (NAM) protein | ||||
TrEMBL | A0A1E5V4C4 | 3e-65 | A0A1E5V4C4_9POAL; NAC domain-containing protein 79 | ||||
STRING | Pavir.Ba02955.1.p | 3e-64 | (Panicum virgatum) | ||||
STRING | Pavir.Eb00839.1.p | 3e-64 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1452 | 37 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 7e-64 | NAC domain containing protein 100 |
Publications ? help Back to Top | |||
---|---|---|---|
|