PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00524.1.g00140.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family STAT
Protein Properties Length: 330aa    MW: 36409.2 Da    PI: 8.0818
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00524.1.g00140.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT188.77e-591362541119
                            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskc 78 
                                     l+vvl++a+g++v kd evvasL+yad+g+vveks dd+e+pLLi+++G e+++ +rp++++rGra+fklkisqLsskc
  Zpz_sc00524.1.g00140.1.am.mkhc 136 LEVVLIDAFGEAV-KDREVVASLVYADNGAVVEKSrDDSEPPLLITCEGFEYPAISRPIPIIRGRALFKLKISQLSSKC 213
                                     79**********9.*********************9******************************************* PP

                            STAT  79 dnrLfrikfeipklkkypfleavskpirCisrsrntrsssl 119
                                     dn+Lfri+f+++++++ypflea+skpirCisr r++rs+++
  Zpz_sc00524.1.g00140.1.am.mkhc 214 DNKLFRIHFSTLHMQRYPFLEAYSKPIRCISRHRTSRSLGS 254
                                     ************************************98765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
GKNLTSDSYT LSPPFRPPAM AAPECSGNEG YRDLRDVRVE LNSGMVRGGA EGFTVCFWLY  60
LASSARPSSV ILHQVTENVM RFHIDGDLIT EAHLCSLSNE PDHQNDANLI SLVGNDDKLE  120
GYAYNIEASC RRNFILEVVL IDAFGEAVKD REVVASLVYA DNGAVVEKSR DDSEPPLLIT  180
CEGFEYPAIS RPIPIIRGRA LFKLKISQLS SKCDNKLFRI HFSTLHMQRY PFLEAYSKPI  240
RCISRHRTSR SLGSGKRVTS ATMGKTNMLS DSQGFINADN VNGLLNSHGQ SLVGSFHSSN  300
SAKTEDGVGK AETHKMVPQN KHARKMVASR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00524.1.g00140.1.am.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795117.11e-124SH2 domain-containing protein B-like
TrEMBLA0A1Z5SB911e-133A0A1Z5SB91_SORBI; Uncharacterized protein
STRINGOGLUM10G19040.11e-125(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75473135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.24e-29SH2 domain protein B