PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00505.1.g00180.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Nin-like
Protein Properties Length: 381aa    MW: 42001 Da    PI: 11.1939
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00505.1.g00180.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK58.51.3e-184686848
                        RWP-RK  8 edlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                                  ++l+ +F+l i+dAA eLg+c++ LKriCR +G++RWP R 
  Zpz_sc00505.1.g00180.1.am.mk 46 QVLATHFHLRIEDAAAELGICQSSLKRICRSHGVPRWPGRM 86
                                  57999*********************************996 PP

2RWP-RK40.45.6e-131181571352
                        RWP-RK  13 yFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                    F+l i+dAA e  +c++ LK iC ++G++RWP  k+++l
  Zpz_sc00505.1.g00180.1.am.mk 118 RFHLRIEDAATEQCICQSSLKSICHKHGVPRWPGTKLSKL 157
                                   7*********************************999986 PP

3RWP-RK29.71.3e-092903211445
                        RWP-RK  14 FslpikdAAkeLgvclTvLKriCRqyGIkRWP 45 
                                    +l ++dAA+ Lg+++  LK  CR +G+ RWP
  Zpz_sc00505.1.g00180.1.am.mk 290 LHLRLNDAASALGISTDRLKFVCRSNGLCRWP 321
                                   6999**************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.82225110IPR003035RWP-RK domain
PfamPF020428.9E-184786IPR003035RWP-RK domain
PfamPF020424.5E-12118157IPR003035RWP-RK domain
PROSITE profilePS5151911.138264354IPR003035RWP-RK domain
PfamPF020424.7E-8288321IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEVLMAAAAR GRTERKRLGF RKEPQKIPCK VAGEVERFWG STACPQVLAT HFHLRIEDAA  60
AELGICQSSL KRICRSHGVP RWPGRMVWFR LEQLSKLAME AMARLGAAPG EDSGHRPRFH  120
LRIEDAATEQ CICQSSLKSI CHKHGVPRWP GTKLSKLAME AMGRQREQHQ GKKVGIVVRK  180
WSPRASARFL MRSLGFFSSQ MLPQYCRNKA VLVQVQLSKS PQAMVDCPPK KSVAVVLGYL  240
KARMRDTGQP TLCQATWPPP STEKKATLVV LTMPRRRAAS PPWSEVLGVL HLRLNDAASA  300
LGISTDRLKF VCRSNGLCRW PGMTVRMNAS IRSGDSLNAK LRRLIQEAAL ARAEASSIAM  360
VASPSSSSPG NDHAGGQKGD S
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00505.1.g00180.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4712633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.29e-09Nin-like family protein