PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00398.1.g00170.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 577aa    MW: 63407 Da    PI: 11.1628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00398.1.g00170.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-17362409148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  Zpz_sc00398.1.g00170.1.am.mk 362 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 409
                                   678*******************************************97 PP

2Myb_DNA-binding45.32.1e-14415457145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   rg++++eE++l++++++ lG++ W+ I+ +++ gRt++++k+ w+
  Zpz_sc00398.1.g00170.1.am.mk 415 RGAFSQEEEDLIIELHAVLGNR-WSQISTRLP-GRTDNEIKNLWN 457
                                   89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-27354412IPR009057Homeodomain-like
PROSITE profilePS5129418.396357409IPR017930Myb domain
SuperFamilySSF466894.77E-29360456IPR009057Homeodomain-like
SMARTSM007176.5E-12361411IPR001005SANT/Myb domain
PfamPF002498.2E-15362409IPR001005SANT/Myb domain
CDDcd001678.08E-11365409No hitNo description
PROSITE profilePS5129424.63410464IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-24413464IPR009057Homeodomain-like
SMARTSM007176.0E-13414462IPR001005SANT/Myb domain
PfamPF002493.2E-13415457IPR001005SANT/Myb domain
CDDcd001672.06E-9417457No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MWRCYAFVDD CLYDTRAELS RVRSTSLLFG SAEPPPSMTP ALSFVVAGYR GPEPRRATDK  60
KPLVSADHAT RQQRAMTGRT TKRNTPASAG RPVPRVRGND GVVVRAVGRR CRLGSAEARA  120
RPGLSSPTDR RSGPLAVRPD RLRYHLPVNI QPQQQPAPPK RQSSIATFVR GTDVTEPPTP  180
TTRTRSSSSS SSNFRRRGRS RVTSIPAEVR RRPVDRKGQA APSAAREPVT VLKDRSYGRV  240
VSAVCGGYTR ARSLLPCCPA PRADATSSSS SIRPFRRARA HSGPGRRVLV PAGLLAAGER  300
NRTDGVAAAK GRRPERGAKT EPCSLALYAR AHSSYRLQSS ASASAFLSMG RHSCCYKQKL  360
RKGLWSPEED EKLMNHITKH GHGCWSTVPK LAGLQRCGKS CRLRWINYLR PDLKRGAFSQ  420
EEEDLIIELH AVLGNRWSQI STRLPGRTDN EIKNLWNSSI KKKLRQKGID PNTHKPLAEV  480
EHSKAAPIIS TERTSESSDF DPSIGGAIGN LNHIMSETAQ SPELLPVLGH QTINNLEELE  540
SRVPNSTGIP LILAAPVAEE AVEAKAWDLS CRERAHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-283604645108B-MYB
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194211RRRGRSRVTSIPAEVRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00398.1.g00170.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794170.0HF679417.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB11 protein.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.15e-88myb domain protein 61