PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00356.1.g00310.1.sm.mkhc | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 83aa MW: 9273.51 Da PI: 10.1275 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.9 | 5.8e-18 | 7 | 41 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++Cg+t+TplWR+gp ++ LCnaCG ++r kg+ Zpz_sc00356.1.g00310.1.sm.mkhc 7 CRHCGVTSTPLWRNGPPDKPVLCNACGSRFRTKGS 41 ****************55555***********997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 4.3E-9 | 1 | 53 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 8.55E-13 | 5 | 48 | No hit | No description |
CDD | cd00202 | 2.57E-13 | 6 | 40 | No hit | No description |
PROSITE profile | PS50114 | 11.583 | 7 | 40 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 8.8E-16 | 7 | 41 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.2E-13 | 7 | 41 | IPR013088 | Zinc finger, NHR/GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MGKQGPCRHC GVTSTPLWRN GPPDKPVLCN ACGSRFRTKG SLANYTPMHR RYDIVDDEPR 60 VSRLRPPASK PKAQKTEGNH EES |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc00356.1.g00310.1.sm.mkhc |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025825662.1 | 8e-44 | GATA transcription factor 26-like isoform X1 | ||||
Refseq | XP_025825663.1 | 8e-44 | GATA transcription factor 26-like isoform X2 | ||||
Refseq | XP_025825664.1 | 8e-44 | GATA transcription factor 26-like isoform X3 | ||||
Swissprot | Q8W4H1 | 2e-28 | GAT26_ARATH; GATA transcription factor 26 | ||||
TrEMBL | A0A0A9DBB7 | 2e-42 | A0A0A9DBB7_ARUDO; Uncharacterized protein | ||||
TrEMBL | A0A2S3I7V3 | 2e-42 | A0A2S3I7V3_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2S3I815 | 2e-42 | A0A2S3I815_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7CWQ2 | 2e-42 | A0A2T7CWQ2_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8ICY3 | 2e-42 | A0A2T8ICY3_9POAL; Uncharacterized protein | ||||
TrEMBL | K3Y9H1 | 4e-43 | K3Y9H1_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Ga01522.1.p | 1e-42 | (Panicum virgatum) | ||||
STRING | Pavir.Gb01403.1.p | 4e-43 | (Panicum virgatum) | ||||
STRING | Si010863m | 6e-44 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4424 | 34 | 64 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17570.3 | 9e-31 | GATA transcription factor 26 |