PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00322.1.g00200.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 434aa    MW: 45894.1 Da    PI: 5.6124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00322.1.g00200.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-1663110148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg W++eEd++l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Zpz_sc00322.1.g00200.1.am.mk  63 RGLWSPEEDDKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 110
                                   788*******************************************97 PP

2Myb_DNA-binding51.52.4e-16116160147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++++eE++l+++++  lG++ W+ Ia+ ++ gRt++++k++w++y
  Zpz_sc00322.1.g00200.1.am.mk 116 RGAFSQEEEDLIIHLHSVLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 160
                                   89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-2558113IPR009057Homeodomain-like
PROSITE profilePS5129418.66858110IPR017930Myb domain
SuperFamilySSF466891.76E-2961157IPR009057Homeodomain-like
SMARTSM007177.3E-1362112IPR001005SANT/Myb domain
PfamPF002493.3E-1563110IPR001005SANT/Myb domain
CDDcd001672.00E-1166110No hitNo description
PROSITE profilePS5129426.796111165IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-26114165IPR009057Homeodomain-like
SMARTSM007171.9E-15115163IPR001005SANT/Myb domain
PfamPF002494.0E-15116160IPR001005SANT/Myb domain
CDDcd001675.83E-11118161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MPRAPEVQQG HASMEVLLSP SVRCPRFLAT AVELESSLGL LAAVAPAARM ARRVAGPKKK  60
LRRGLWSPEE DDKLMNHIAK YGHGCWSSVP KLAGLERCGK SCRLRWINYL RPDLKRGAFS  120
QEEEDLIIHL HSVLGNKWSQ IAAQLPGRTD NEVKNFWNSY IKKKLRQRGI DPATHKPLAV  180
EAASSGRAAS AASSRSAVFV DAEFILSSTT AGQHMPPLAV TAESYNDMYS HSSAEGGGSA  240
SAALVGGACS DGSLSLSGYN QTADLATGYL DPAVVLPSVS SSSTLNSIAG LSPAATDEQC  300
NNSNSAFEST PSCSAAATDH LPWLELGSSS YCTTAAAVDH YGAALDELKW SDYVFDGYGA  360
AQYQQPGQGV YGDSKDAVQF DADGLSSWLL PCWSPLLRGR LEGPPDGRTA ADGPTGSDGA  420
DAENDGQAER PFAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29611655108B-MYB
1h8a_C2e-295216518128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00322.1.g00200.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0340161e-131BT034016.1 Zea mays full-length cDNA clone ZM_BFc0036C19 mRNA, complete cds.
GenBankBT0353991e-131BT035399.1 Zea mays full-length cDNA clone ZM_BFb0059D04 mRNA, complete cds.
GenBankBT0409891e-131BT040989.1 Zea mays full-length cDNA clone ZM_BFc0162L22 mRNA, complete cds.
GenBankBT0675251e-131BT067525.1 Zea mays full-length cDNA clone ZM_BFc0072I17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802131.11e-155transcription factor MYB61-like
TrEMBLA0A0A9P2E31e-161A0A0A9P2E3_ARUDO; Uncharacterized protein
STRINGSi029872m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.13e-73myb domain protein 50