PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00186.1.g00280.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 303aa    MW: 35057.5 Da    PI: 8.15
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00186.1.g00280.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-5461331128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePwdL  k  + ++++ewyfF +rd+ky++g r+nrat+
  Zpz_sc00186.1.g00280.1.am.mk   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWDLAeKsFLPGTDSEWYFFGPRDRKYPNGCRTNRATR 85 
                                   79****************************.99**************84334555788*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWk+tgkd++v   +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  Zpz_sc00186.1.g00280.1.am.mk  86 AGYWKSTGKDRRVSY-QNRSIGMKKTLVYYKGRAPQGLRTNWVMHEYRI 133
                                   **************9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-634156IPR003441NAC domain
PROSITE profilePS5100559.4236156IPR003441NAC domain
PfamPF023651.0E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWD LAEKSFLPGT  60
DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRVSY QNRSIGMKKT LVYYKGRAPQ  120
GLRTNWVMHE YRIEESECDN TMGIQDSYAL CRVFKKNVAV GESEKQAECS TSKAKGNQER  180
LTNFGDVRET SAVAIRRRRA PPFTHLGSDR WRTDHCLDEE HEWTPGRARD LTPLQRFPHE  240
QRHKCLAPSL VLDEMPEPEE GLEAWRPHLC WNTPLALTVG TSRLQILQSR CRIEDAGLNS  300
PNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-54615720169NAC domain-containing protein 19
3swm_B5e-54615720169NAC domain-containing protein 19
3swm_C5e-54615720169NAC domain-containing protein 19
3swm_D5e-54615720169NAC domain-containing protein 19
3swp_A5e-54615720169NAC domain-containing protein 19
3swp_B5e-54615720169NAC domain-containing protein 19
3swp_C5e-54615720169NAC domain-containing protein 19
3swp_D5e-54615720169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00186.1.g00280.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008653036.11e-122NAC domain-containing protein 45
RefseqXP_025803497.11e-122NAC domain-containing protein 45-like
SwissprotQ9FFI52e-85NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0A9HWW61e-128A0A0A9HWW6_ARUDO; NAC017
STRINGLPERR09G14720.11e-125(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-100NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]