PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00045.1.g00150.1.am.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 172aa MW: 18737.2 Da PI: 8.2308 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 34.4 | 6.7e-11 | 36 | 82 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 lppGf+F P+de+lvv++L++k+++ +++ ++i++v +++++Pw+L++ Zpz_sc00045.1.g00150.1.am.mk 36 LPPGFHFFPSDEDLVVHFLRRKAANVPCRP-DIIPTV-LHRYDPWELNA 82 79*************************999.778876.99*******83 PP | |||||||
2 | NAM | 45.5 | 2.5e-14 | 83 | 136 | 74 | 128 |
NAM 74 knratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + r+ sg W+ g d++v++ +g vglkkt++f +g+ kg kt+Wvmhey+l Zpz_sc00045.1.g00150.1.am.mk 83 QGRTSPSGCWNPIGADETVTC-SGCSVGLKKTFIFCTGEPLKGFKTNWVMHEYHL 136 568889***************.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-34 | 31 | 143 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 13.475 | 36 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.4E-16 | 37 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MRKANPKGGG WLGLETGWGS DEGRADHIRM GGATNLPPGF HFFPSDEDLV VHFLRRKAAN 60 VPCRPDIIPT VLHRYDPWEL NAQGRTSPSG CWNPIGADET VTCSGCSVGL KKTFIFCTGE 120 PLKGFKTNWV MHEYHLLDGG GYNASGGSTS GVQQLGDMPS LRIKLRRASE LP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-22 | 35 | 145 | 16 | 151 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-22 | 35 | 145 | 16 | 151 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-22 | 35 | 145 | 16 | 151 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-22 | 35 | 145 | 16 | 151 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swm_B | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swm_C | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swm_D | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swp_A | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swp_B | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swp_C | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
3swp_D | 1e-22 | 35 | 145 | 19 | 154 | NAC domain-containing protein 19 |
4dul_A | 1e-22 | 35 | 145 | 16 | 151 | NAC domain-containing protein 19 |
4dul_B | 1e-22 | 35 | 145 | 16 | 151 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc00045.1.g00150.1.am.mk |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021314570.1 | 1e-64 | NAC domain-containing protein 104 isoform X2 | ||||
TrEMBL | A0A0A9FYS5 | 7e-64 | A0A0A9FYS5_ARUDO; Uncharacterized protein | ||||
STRING | Si018368m | 1e-62 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 2e-28 | NAC domain containing protein 25 |