PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00022.1.g00280.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 342aa    MW: 39627.1 Da    PI: 10.502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00022.1.g00280.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-14453148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                                  r+rW +eEd  l  +v+q+G++ W++++++m+  + R +k+c +rw +yl
  Zpz_sc00022.1.g00280.1.sm.mk  4 RQRWRPEEDAVLRAYVRQYGPREWHLVSQRMNvaLDRDAKSCLERWKNYL 53
                                  89**********************************************97 PP

2Myb_DNA-binding36.51.1e-1159103147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Zpz_sc00022.1.g00280.1.sm.mk  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                                   6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.82153IPR017930Myb domain
SMARTSM007171.3E-11355IPR001005SANT/Myb domain
SuperFamilySSF466893.01E-21498IPR009057Homeodomain-like
CDDcd001676.62E-7653No hitNo description
Gene3DG3DSA:1.10.10.603.8E-20660IPR009057Homeodomain-like
PfamPF139213.3E-13768No hitNo description
PROSITE profilePS5129423.37554108IPR017930Myb domain
SMARTSM007172.8E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-1561102IPR009057Homeodomain-like
CDDcd001671.79E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MKERQRWRPE EDAVLRAYVR QYGPREWHLV SQRMNVALDR DAKSCLERWK NYLRPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE LRGSRRPPPE  120
PSPDERGRYE WLLENFAEKL VNERLQPTPL LMAAPVLPPW LSSSATRHTV VTQPPSPSVT  180
LSLASAPTPP ATVPPWMPAE RGAAADAFGF TTPQPPPAGA PTXXXXCREL EEGQRAWAAH  240
RREAAWRLRR VEQQLEAERE ARRREVWEEF EAKKRAVRGE QAAAAERLER EYREKEAELR  300
RDAQAKEEKM AEQWAAKHAR VAKFLEQVGG CHPRPWSSAE MN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-157101798MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-157101798C-Myb DNA-Binding Domain
1msf_C6e-157101798C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. Interacts directly with asymmetric leaves 2 (AS2) to repress the knox homeobox genes. {ECO:0000269|PubMed:10102816, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:9655808}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00022.1.g00280.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1264890.0AF126489.1 Zea mays rough sheath2 protein (rs2) gene, complete cds.
GenBankAF1434470.0AF143447.1 Zea mays rough sheath 2 (rs2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020182147.11e-152protein rough sheath 2
SwissprotQ9S7B21e-150RS2_MAIZE; Protein rough sheath 2
TrEMBLA0A3B6LHD01e-151A0A3B6LHD0_WHEAT; Uncharacterized protein
TrEMBLA0A446TY021e-151A0A446TY02_TRITD; Uncharacterized protein
STRINGTraes_5BS_E635B0A281.21e-152(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.13e-82MYB family protein