PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc10776.1.g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 62aa MW: 6382.39 Da PI: 9.0464 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 49.3 | 1.4e-15 | 28 | 62 | 1 | 35 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhk 35 +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk Zmw_sc10776.1.g00010.1.sm.mk 28 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHK 62 7*********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 14.66 | 27 | 62 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.0E-14 | 28 | 62 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MASPSSTSNS AMSPVAAPGT TTPGAGAPCA ACKFLRRKCL PGCVFAPYFP PEEPQKFANV 60 HK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-25 | 21 | 62 | 4 | 45 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-25 | 21 | 62 | 4 | 45 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025818403.1 | 4e-34 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_025818404.1 | 4e-34 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 5e-19 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2S3HY84 | 9e-33 | A0A2S3HY84_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7DRP8 | 9e-33 | A0A2T7DRP8_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6SKA6 | 9e-33 | A0A3L6SKA6_PANMI; LOB domain-containing protein 4-like | ||||
STRING | Pavir.J38993.1.p | 5e-33 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8813 | 35 | 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|