PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc06063.1.g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 150aa MW: 16254.6 Da PI: 8.0354 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.2 | 4.2e-57 | 28 | 122 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyve 81 vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+e Zmw_sc06063.1.g00010.1.am.mk 28 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIE 108 69******************************************************************************* PP NF-YB 82 plkvylkkyreleg 95 plkvyl+kyre+ + Zmw_sc06063.1.g00010.1.am.mk 109 PLKVYLQKYREVLS 122 ***********966 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.3E-53 | 27 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.59E-40 | 31 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-28 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.2E-23 | 62 | 80 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.2E-23 | 81 | 99 | No hit | No description |
PRINTS | PR00615 | 6.2E-23 | 100 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MADGPTSPGG GGGSHESGSP RGGGGGGVRE QDRFLPIANI SRIMKKAVPA NGKIAKDAKE 60 TVQECVSEFI SFITSEASDK CQREKRKTIN GDDLLWAMAT LGFEEYIEPL KVYLQKYREV 120 LSKRDGVKTV ELLTTPFIGL VEDIKKSMCS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-49 | 27 | 119 | 1 | 93 | NF-YB |
4awl_B | 3e-49 | 27 | 119 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-49 | 27 | 119 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00300 | DAP | Transfer from AT2G38880 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022145604.1 | 2e-68 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Swissprot | P25209 | 8e-63 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | V4SNQ4 | 7e-68 | V4SNQ4_9ROSI; Uncharacterized protein | ||||
STRING | XP_010244998.1 | 2e-67 | (Nelumbo nucifera) | ||||
STRING | XP_010253500.1 | 2e-67 | (Nelumbo nucifera) | ||||
STRING | XP_010046844.1 | 3e-67 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Publications ? help Back to Top | |||
---|---|---|---|
|