PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04743.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 958aa    MW: 105554 Da    PI: 8.7521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04743.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-15608655148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd +l+ ++++ G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc04743.1.g00060.1.am.mk 608 KGSWTPEEDMRLIAYIQKCGHANWRALPKQAGLLRCGKSCRLRWINYL 655
                                   799*****************************99************97 PP

2Myb_DNA-binding46.96.3e-15661710146
                                   TSSS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqk 46 
                                   rg++T eE+e +++++++lG++     +W++Ia++++ gRt++++k+ w++
  Zmw_sc04743.1.g00060.1.am.mk 661 RGNFTVEEEESIIKLHAMLGNKydaalQWSKIAACLP-GRTDNEIKNVWNT 710
                                   89***********************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF050565.6E-705195IPR007750Protein of unknown function DUF674
Gene3DG3DSA:1.10.10.601.7E-22599658IPR009057Homeodomain-like
PROSITE profilePS5129420.658603659IPR017930Myb domain
SuperFamilySSF466891.21E-26605708IPR009057Homeodomain-like
SMARTSM007171.7E-12607657IPR001005SANT/Myb domain
PfamPF002494.8E-14608655IPR001005SANT/Myb domain
CDDcd001679.75E-10610655No hitNo description
Gene3DG3DSA:1.10.10.601.8E-22659715IPR009057Homeodomain-like
SMARTSM007174.3E-11660714IPR001005SANT/Myb domain
PROSITE profilePS5129415.068660716IPR017930Myb domain
PfamPF002494.0E-13661710IPR001005SANT/Myb domain
CDDcd001672.70E-9663712No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 958 aa     Download sequence    Send to blast
MSKKEEPTIE AKLFIVREKG KVLFAESDKE FVDVLLSFLT LPLGTVVRLL GKQSQIGCLD  60
QIYKSVEELS SDYFQTKACK SMVLSPRNAA SSHCDRLKIN VDDSNPWAVY VCKDEKCRYG  120
EFSLVPDAIC KCGKVMQYAG NMPVKDRNLA PCPGGGNTAT SVFVKGGYTF IITDDLMVAP  180
SSTSLVMSLC ERSEIHGVTC DGERRARTVG ERREVSTCSD VDGGRRSNLS DSSSASAVKR  240
LAIFHTRFDN KENGVTRAET RRLVDTPTGD YAEANGLRSR SRPNRNWKPR IPCNISHPAV  300
SHHRAGAACQ SIGLARPTEC SAHVSPAPRL SLPGDAAVMG LAVRRESSSQ LAAAARDDGS  360
VRGFTPASET AQTPAAFGVA LYHPLARTWR RSYHPRVLHQ FFQLPLSFAI RGKAGWRRRL  420
WVPWSGGGAQ TDLANIDERT LMLRPFHPSD TIAVRSNVSP HRVSATRYNK SNSDNVRDLQ  480
DERKQACVKG CPRRPCRGNQ RTRNAGRTLR FVGNWRGLQK APKREAGSVV EFGEAGLRRW  540
VRACREGDTA AACVTCRTRQ RTRREPPPRA RHRRREQSIT RRRSLRCLWP GLMGKGRAPC  600
CAKVGLNKGS WTPEEDMRLI AYIQKCGHAN WRALPKQAGL LRCGKSCRLR WINYLRPDLK  660
RGNFTVEEEE SIIKLHAMLG NKYDAALQWS KIAACLPGRT DNEIKNVWNT RLKKRVAPCG  720
EQEHTAKKKK KKNSAGAEAT VPSPSPASST TTTTNCSSGD SGEQQSNASC KEPDELDLKT  780
LNIPTLDTAG FDFDFDFDLD MLVDHPAPEL HHPSLSVPTS PCASSTSPPA PATNVDGLLA  840
LPEIDIDQEL WSIIDGDGAC SFTETPAPPC HGNATEPDAA TTSREEDGKE WWLENLEREL  900
GLWGPVEDYQ CPAGPLGLAE PDLPPMVQEQ DPVTCYFQAG STAAPLQGPE LSSNQMTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2360671625128MYB TRANSFORMING PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1712731KKRVAPCGEQEHTAKKKKKK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798