PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc04657.1.g00080.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 96aa MW: 10992.5 Da PI: 6.2304 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 80.7 | 2.3e-25 | 32 | 90 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+ +++++sw ++ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y Zmw_sc04657.1.g00080.1.am.mk 32 FLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY 90 9********************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.4E-27 | 23 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.5E-22 | 28 | 93 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 3.67E-23 | 31 | 90 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 1.9E-21 | 32 | 90 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.7E-16 | 32 | 55 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.7E-16 | 70 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.7E-16 | 83 | 95 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MAFQLVERCG EMVVSTMESS AHAKPAPVPA PFLTKTYQLV DDPCTDHIVS WGDDDTTFVV 60 WRPPEFARDL LPNYFKHNNF SSFVRQLNTY VRKALV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 5e-18 | 23 | 96 | 12 | 84 | Heat shock factor protein 1 |
5d5u_B | 6e-18 | 23 | 96 | 21 | 93 | Heat shock factor protein 1 |
5d5v_B | 6e-18 | 23 | 96 | 21 | 93 | Heat shock factor protein 1 |
5d5v_D | 6e-18 | 23 | 96 | 21 | 93 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025804091.1 | 2e-52 | heat stress transcription factor B-4b-like | ||||
Swissprot | Q7XHZ0 | 2e-49 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
TrEMBL | A0A2S3H4D8 | 6e-51 | A0A2S3H4D8_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7EZ90 | 5e-51 | A0A2T7EZ90_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6QPD0 | 6e-51 | A0A3L6QPD0_PANMI; Heat stress transcription factor B-4b-like | ||||
STRING | Pavir.J32257.1.p | 6e-53 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Publications ? help Back to Top | |||
---|---|---|---|
|