PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc04334.1.g00070.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 111aa MW: 11707.4 Da PI: 10.2606

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc04334.1.g00070.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.8	4.5e-31	59	109	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRr g+lKKA+ELSvLCdae+a+++fss+g+lyeys+ Zmw_sc04334.1.g00070.1.sm.mk 59 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 109 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE pattern	PS00350	0	53	107	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.9E-31	53	73	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.01E-27	54	110	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.41E-36	54	110	No hit	No description
SMART	SM00432	7.8E-35	54	110	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.857	55	111	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.5E-26	60	107	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.9E-31	73	88	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.9E-31	88	109	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MEAAQSTDLM SAALTSVGLK QKDPLPSPGT GSVAAAASTA GAAEKAAAAG NKGKKVEIKR 60 IENTTNRQVT FCKRRSGLLK KAYELSVLCD AEIALVVFSS RGRLYEYSNN R

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
1tqe_Q	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
1tqe_R	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
1tqe_S	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
6c9l_A	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
6c9l_B	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
6c9l_C	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
6c9l_D	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
6c9l_E	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
6c9l_F	5e-20	54	108	4	58	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004960599.1	2e-40	MADS-box transcription factor 58
Swissprot	Q2V0P1	5e-36	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	K3ZAE5	5e-41	K3ZAE5_SETIT; Uncharacterized protein
STRING	Si023516m	8e-42	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]