PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc03718.1.g00010.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

G2-like

Protein Properties

Length: 85aa MW: 9304.75 Da PI: 10.217

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc03718.1.g00010.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	100.1	1.4e-31	35	85	1	51
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQ Zmw_sc03718.1.g00010.1.sm.mk 35 KPRLRWTAELHDRFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQ 85 79************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.5E-30	32	85	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.729	32	85	IPR017930	Myb domain
SuperFamily	SSF46689	4.84E-15	34	85	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.2E-22	35	85	IPR006447	Myb domain, plants
Pfam	PF00249	1.0E-8	37	85	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MFPSSSKKPS TASANDRPMC VQDDSGGLVL TTDPKPRLRW TAELHDRFVD AVAQLGGPDK 60 ATPKTIMRVM GVKGLTLYHL KSHLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	2e-19	35	85	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	2e-19	35	85	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	2e-19	35	85	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	2e-19	35	85	1	51	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269\|PubMed:14614507, ECO:0000269\|PubMed:18523061, ECO:0000269\|PubMed:25081480, ECO:0000269\|PubMed:26239308, ECO:0000305\|PubMed:15592750}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269\|PubMed:15592750}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025810576.1	2e-51	myb family transcription factor APL-like
Swissprot	Q9SAK5	5e-41	APL_ARATH; Myb family transcription factor APL
TrEMBL	A0A2S3HH91	6e-50	A0A2S3HH91_9POAL; Uncharacterized protein
STRING	Pavir.Db00488.1.p	7e-51	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP20734	6	7

Publications ? help Back to Top
Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R Vascular gene expression: a hypothesis. Front Plant Sci, 2013. 4: p. 261 [PMID:23882276] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kondo Y, et al. Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells. Plant Cell, 2016. 28(6): p. 1250-62 [PMID:27194709] Shibuta M,Abe M FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells. Plant Cell Physiol., 2017. 58(11): p. 2017-2025 [PMID:29036620]