PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03565.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 374aa    MW: 40130 Da    PI: 9.9424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03565.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.6e-1991136147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  Zmw_sc03565.1.g00060.1.am.mk  91 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 136
                                   79******************************.***********985 PP

2Myb_DNA-binding52.21.4e-16143186146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   r ++T+eEd  +++a ++lG++ W++Iar ++ gRt++ +k++w++
  Zmw_sc03565.1.g00060.1.am.mk 143 RRPFTPEEDATILRARTELGNR-WAAIARLLP-GRTDNAVKNHWNS 186
                                   679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.48186141IPR017930Myb domain
SuperFamilySSF466894.12E-3188184IPR009057Homeodomain-like
SMARTSM007179.6E-1790139IPR001005SANT/Myb domain
PfamPF002495.3E-1891136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2592144IPR009057Homeodomain-like
CDDcd001671.02E-1593135No hitNo description
SMARTSM007177.3E-15142190IPR001005SANT/Myb domain
PfamPF002496.5E-14143186IPR001005SANT/Myb domain
PROSITE profilePS5129419.722143192IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-23145192IPR009057Homeodomain-like
CDDcd001671.87E-11145188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MPSGAANTTR PTSGEVAPRQ LYPVAEQPAA PGHSAHRSGY ISPRLDLPFH LATDRDVPIE  60
LITHSTITAA AVADLQLGKD QITEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG  120
IPGRSGKSCR LRWCNQLSPQ VERRPFTPEE DATILRARTE LGNRWAAIAR LLPGRTDNAV  180
KNHWNSSLKR KVVATATTDA AAERPCKRVS PAPGSPTGSD RSELSHGSVG CGGAQVYRPV  240
PRPGGFDTIR SANVRPTPSA PTSGRGEDPL TSLSLSLPGQ DQQGSSGFRH DSVRSHFQEL  300
SPSRSPSPQP SHYPFSGELV AAMQDMIRAE VRKYMSGVGL RAGCGPGAAG EKSIVEGVMR  360
AAAERVGVVT SRQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-39881924108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147631.11e-143uncharacterized protein LOC100281240
SwissprotQ9FDW14e-69MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A3L6RS061e-143A0A3L6RS06_PANMI; Uncharacterized protein
STRINGGRMZM2G145444_P011e-142(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Publications ? help Back to Top
  1. Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y
    Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance.
    Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62
    [PMID:24275141]
  2. Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ
    Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence.
    BMC Plant Biol., 2013. 13: p. 192
    [PMID:24286353]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Li D, et al.
    Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44.
    Int J Mol Sci, 2014. 15(5): p. 8473-90
    [PMID:24828206]
  5. Xu DB, et al.
    A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis.
    PLoS ONE, 2015. 10(1): p. e0116385
    [PMID:25635681]
  6. Hieno A, et al.
    Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis.
    Microbes Environ., 2016. 31(2): p. 154-9
    [PMID:27301421]
  7. Zhao Q, et al.
    AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana.
    Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785
    [PMID:27604593]
  8. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  9. Nguyen NH,Cheong JJ
    H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress.
    Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043
    [PMID:29649476]
  10. Nguyen NH,Cheong JJ
    AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription.
    Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442
    [PMID:30448055]