PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc03552.1.g00110.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 129aa MW: 15015.2 Da PI: 9.6908 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.2 | 7.9e-32 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs +gklyeyss Zmw_sc03552.1.g00110.1.sm.mkhc 10 RIENKVNRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSAKGKLYEYSS 59 8***********************************************96 PP | |||||||
2 | K-box | 14.8 | 1.2e-06 | 86 | 112 | 67 | 93 |
K-box 67 skKnellleqieelqkkekelqeenka 93 + +n+l++++i elqkkek+l ++n + Zmw_sc03552.1.g00110.1.sm.mkhc 86 ADQNQLMFDSIFELQKKEKMLIDQNGY 112 679******************999976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.057 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.5E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.13E-42 | 2 | 74 | No hit | No description |
SuperFamily | SSF55455 | 8.63E-33 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.2E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MGRGPVQLRR IENKVNRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFSA KGKLYEYSSH 60 ASMEGILERY HRYSFEERAA LDPTVADQNQ LMFDSIFELQ KKEKMLIDQN GYVNLVEHTN 120 LNRNHVLHK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002460989.1 | 1e-54 | MADS-box transcription factor 18 | ||||
Swissprot | A2YNI2 | 1e-52 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
Swissprot | Q0D4T4 | 1e-52 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
TrEMBL | C5XDW7 | 3e-53 | C5XDW7_SORBI; Uncharacterized protein | ||||
STRING | Sb02g038780.1 | 5e-54 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |